Loading...
Statistics
Advertisement

Hln.co

Advertisement
Hln.co is hosted in United States / New York . Hln.co doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Hln.co

Technology

Number of occurences: 3
  • Html
  • Html5
  • Javascript

Advertisement

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Hln.co

Missing HTTPS protocol.

    Meta - Hln.co

    Number of occurences: 3
    • Name:
      Content: 0; url=/legacy
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: description
      Content: See related links to what you are looking for.

    Server / Hosting

    • IP: 199.59.243.120
    • Latitude: 40.74
    • Longitude: -73.98
    • Country: United States
    • City: New York

    Rname

    • ns1.bodis.com
    • ns2.bodis.com

    Target

    • dnsadmin.bodis.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Wed, 24 Aug 2016 20:25:24 GMT Accept-Ranges: bytes ETag: "052b5a445fed11:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Date: Thu, 01 Sep 2016 20:35:08 GMT Content-Length: 2423 X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

    DNS

    host: hln.co
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 199.59.243.120
    host: hln.co
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns1.bodis.com
    host: hln.co
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns2.bodis.com
    host: hln.co
    1. class: IN
    2. ttl: 10800
    3. type: SOA
    4. mname: ns1.bodis.com
    5. rname: dnsadmin.bodis.com
    6. serial: 2016083002
    7. refresh: 10800
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ln.co, www.heln.co, www.eln.co, www.hdln.co, www.dln.co, www.hcln.co, www.cln.co, www.huln.co, www.uln.co, www.hjln.co, www.jln.co, www.hln.co, www.ln.co, www.hbln.co, www.bln.co, www.hgln.co, www.gln.co, www.hn.co, www.hlun.co, www.hun.co, www.hl8n.co, www.h8n.co, www.hl9n.co, www.h9n.co, www.hljn.co, www.hjn.co, www.hl0n.co, www.h0n.co, www.hlmn.co, www.hmn.co, www.hlpn.co, www.hpn.co, www.hlon.co, www.hon.co, www.hl.co, www.hlnn.co, www.hln.co, www.hlnh.co, www.hlh.co, www.hlnj.co, www.hlj.co, www.hlnk.co, www.hlk.co, www.hlnl.co, www.hll.co, www.hln .co, www.hl .co,

    Other websites we recently analyzed

    1. naturaldogdeli.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    2. Home Page
      Dublin (Ireland) - 46.51.204.184
      Server software: nginx
      Technology: CloudFront, CSS, Google Font API, Html
      Number of Javascript: 5
      Number of meta tags: 5
    3. 9¸æž°è¡¾æ»ž
      Ottawa (Canada) - 47.90.10.47
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php
      Number of Javascript: 15
      Number of meta tags: 3
    4. drawwritenow.com
      Lansing (United States) - 67.225.133.85
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    5. İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
      İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
      Germany - 146.0.42.37
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, jQuery Fancybox, Php, SuperFish
      Number of Javascript: 16
      Number of meta tags: 10
    6. Danny's Pizza | A Great Restaurant in Douglas, Georgia
      Scottsdale (United States) - 184.168.165.1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, WordPress Stats, Wordpress
      Number of Javascript: 14
      Number of meta tags: 4
    7. Agence Phiphi PLUS - Agence de Communication PHIPHI+
      Provo (United States) - 50.87.163.120
      G Analytics ID: UA-80660667-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Google Analytics, Joomla
      Number of Javascript: 14
      Number of meta tags: 3
    8. Welkom bij Toyota dealer Autobedrijf Alex van de Velde Zuidzande B.V.
      Dit is de officiële Toyota dealerwebsite van Autobedrijf Alex van de Velde Zuidzande B.V. met o.a. de (hybride) Toyota modellen, Occasions, Acties en Nieuws..
      Netherlands - 193.239.132.218
      Server software: Microsoft-IIS/8.5
      Technology: Carousel, CSS, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 6
    9. Double Blessing International
      Provo (United States) - 162.144.23.71
      Server software: nginx/1.10.1
      Technology: CSS, Html
      Number of meta tags: 3
    10. Õ也坏酵
      Mong Kok (Hong Kong) - 103.27.110.3
      Server software: IIS
      Technology: Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 1

    Check Other Websites